PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG033652.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family NF-YC
Protein Properties Length: 211aa    MW: 23829.9 Da    PI: 10.115
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG033652.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC36.41.1e-111111931799
        NF-YC  17 knhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprd 99 
                      +P+arik+i+ +++  + +  ++  l+ ka e f+ +++  ++  + + ++++l    ++++v++   fdfl d vp++
  CCG033652.1 111 TACWFPMARIKRIINSEDTESLLNQDVVFLVNKATEKFLEQFSDEAYDYTVQDRKKSLAYKHLSTVVSKRRRFDFLSDFVPEK 193
                  55679***************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471136.46E-1695193IPR009072Histone-fold
PfamPF008088.2E-16114177IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.106.0E-22115192IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MKRVAKSKRE MKKKKSSSKE VVVITKSKQE NKKSKSKTSN ISPREPVVLL LSSSSSSSDS  60
QEIIEIEGED DETKSGIKNR SMKSSKIKSA NNAKRKGKDD DFDGEGDEDG TACWFPMARI  120
KRIINSEDTE SLLNQDVVFL VNKATEKFLE QFSDEAYDYT VQDRKKSLAY KHLSTVVSKR  180
RRFDFLSDFV PEKLNAKDAL ADRKLAMTGQ G
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1163181RKKSLAYKHLSTVVSKRRR
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU2257764e-60CU225776.1 Populus EST from leave.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011044380.11e-151PREDICTED: DNA polymerase epsilon subunit C
TrEMBLB9HQA81e-116B9HQA8_POPTR; Histone-like transcription factor family protein
STRINGPOPTR_0009s01750.11e-116(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120163031
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07980.12e-32nuclear factor Y, subunit C10